PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_003206-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 309aa    MW: 35159.3 Da    PI: 6.6202
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_003206-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.5e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++  G+g +W + ++++g++R++k+c++rw++yl
  AHYPO_003206-RA 14 KGPWSPEEDAKLKAYIEAKGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding40.28e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eE+ ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
  AHYPO_003206-RA  69 GGFTEEEENIICNLYINIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.122962IPR017930Myb domain
SuperFamilySSF466891.84E-2511109IPR009057Homeodomain-like
SMARTSM007171.7E-111364IPR001005SANT/Myb domain
PfamPF002497.2E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-231569IPR009057Homeodomain-like
CDDcd001675.52E-81662No hitNo description
PROSITE profilePS5129421.44263117IPR017930Myb domain
SMARTSM007174.7E-1167115IPR001005SANT/Myb domain
PfamPF002493.0E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-2470118IPR009057Homeodomain-like
CDDcd001677.05E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKAYIE AKGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FTEEEENIIC NLYINIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLIAK  120
QRKEQQAAYR FVEQELKREN ETFLVNQTIN QIPNTFWSEQ QSCIPPMIMD PNQDQITRFL  180
MKSSGMIYDD QSHHPQLINS NYDDHHLFNH VGTSDQIDPA YTQLVNNTGY YYDHVNGVGP  240
TSNQENEKYF AEIEAYLSNQ LRFEDGIDMG SNSTNSDSGG NSWGEMCSLV NTPVSNFNAY  300
QNGTLQAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-23141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010679693.11e-129PREDICTED: transcription factor RAX3
SwissprotQ9M2Y92e-89RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0J8C8G81e-129A0A0J8C8G8_BETVU; Uncharacterized protein
STRINGVIT_00s1352g00010.t012e-95(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.13e-87myb domain protein 84